PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 285aa    MW: 31325.1 Da    PI: 5.702
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013026.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-20120180257
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  r+R+t+t+ ql++Le+ F + n +ps+ +++e++ +l    +++e++V++WFqNrRa+ k+
  Aco013026.1 120 RQRWTPTPMQLQILETIFDQgNGTPSKLKIKEITLELsqhgQISETNVYNWFQNRRARSKR 180
                  89*****************99**************************************97 PP

2Wus_type_Homeobox100.31.4e-32119182265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPtp Q++iLe+++++G  tP+k +i++it eL+++G+i+++NV++WFQNr+aR+++kq
        Aco013026.1 119 PRQRWTPTPMQLQILETIFDQGNGTPSKLKIKEITLELSQHGQISETNVYNWFQNRRARSKRKQ 182
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-17115186IPR009057Homeodomain-like
PROSITE profilePS5007114.382116181IPR001356Homeobox domain
SuperFamilySSF466896.84E-19118186IPR009057Homeodomain-like
SMARTSM003896.2E-14118185IPR001356Homeobox domain
CDDcd000863.14E-13119182No hitNo description
PfamPF000463.3E-18120180IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEWEKGGPRR SKAATTTTTT MMVEEEEAEE RRRRGGGGGG GGGGVEAEGI VEGGLYVKVM  60
TDEQMEVLRK QISIYATICE QLVEMHKAIT AQQDSLAGMR LGSLYCDPLM TPGGHKITPR  120
QRWTPTPMQL QILETIFDQG NGTPSKLKIK EITLELSQHG QISETNVYNW FQNRRARSKR  180
KQNAASANNA ESEFEVDDES PSEKKPKSEK PHDVSPAMAG EISIHSSEMN SQMHAIDPVP  240
PCRNQGFYAS NDSSRSSGSS GQMPFYENIL ASPNAVVQLN YPFL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6612851e-175KM661285.1 Ananas bracteatus clone 42949 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940220.11e-122PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM31e-98WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLK3XKT51e-103K3XKT5_SETIT; Uncharacterized protein
STRINGSi002508m1e-102(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38983776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.13e-69WUSCHEL related homeobox 13